1924122 | 420lyftd.com | Lyft, Inc. | Stickyleaf Software / Stickyleaf | UDRP | 04-Jan-2021 |
|
1923736 | statefarmpay.online | State Farm Mutual Automobile Insurance Company | hennry williamson | UDRP | 04-Jan-2021 |
|
DAE2020-0005 | tevapharm.ae | Actavis Group PTC ehf | Personal Email | | 10-Dec-2020 |
|
DCO2020-0058 | sodexous.co | Sodexo | WhoisGuard Protected, WhoisGuard, Inc. / Liliane Walton | | 14-Dec-2020 |
|
DES2020-0038 | jdsports.com.es | JD Sports Fashion PLC | Ana García Hernández | | 15-Dec-2020 |
|
DIO2020-0015 | msfinance.io msfunds.io | Morgan Stanley | Registration Private, Domains By Proxy, LLC / Ismail Sokhna, Talibe Sokhna | | 23-Dec-2020 |
|
DSE2020-0048 | kranmärkt.se | Svenskt Vatten AB | U.J., Konsulf | | 20-Dec-2020 |
|
D2020-1657 | laboratoriostevaargentina.com laboratoriotevaargentina.com | Teva Pharmaceutical Industries Limited | Felipe Gamboa / Francisco Ponse / Cindy Nicole Oporto Leal | | 22-Dec-2020 |
|
D2020-2529 | goldengoosehrvatska.com | Golden Goose S.p.A. | 邹亮亮 (Zou Liang Liang) | | 23-Dec-2020 |
|
D2020-2491 | velpeau.com | Laboratoires Lohmann & Rauscher Lohmann & Rauscher GmbH & Co.KG | zhengxiao xing (郑晓星), shen zhen shi wei li jian ke ji zhi pin you xian gong si (深圳市维力健科技制品有限公司), Shenzhen Weprotex Technology Product Co., Ltd | | 23-Dec-2020 |
|
D2020-2486 | guitarcentermusic.com | Guitar Center, Inc. | Luiz Carlos de Arruda Leite | | 15-Dec-2020 |
|
D2020-2424 | helpserviceinstagramverify.comhelpserviceinstagramverifys.cominstagramcopyrighthelpteam.cominstagramhelpcentering.com instagramhelpportal.com instagramhelpscentering.com lnstagram-businessmanagers.com lnstagramclientsportalcenter.com lnstagramcommunitycenter.com lnstagramcoprightes.com lnstagramportalscenter.com lnstagramspecialportals.com lnstagramsupporterscentre.com lnstagramsupportforms.com lnstagramsupportshelp.com lnstagramsupportsmedia.com [13 MORE] | Instagram, LLC | Ahmet Yalman dfd dfdf, dfdf efdwedf wedfwef erdem altan Hasan Yavuz, Jjjj Hhh Hhhh Jxksks Ksmssks Mirac Ertekin ndsmnxsj bzjsjxjs Nsnsnsn Snnndndn Nxnxnx Nxnxnxjsjskks Registration Private, Domains By Proxy, LLC rewgferwg ewgerg Xjjzjz Bzhzhhz Xjkdjd nxksjz | | 30-Dec-2020 |
|
D2020-2789 | pricelinehotline.com | priceline.com LLC | Ryan Foster | | 22-Dec-2020 |
|
D2020-2780 | seeklogo.net | Mr. Yunus GÖNEN | WhoiGuard Protected, WhoisGuard, Inc. WhoiGuard Protected, WhoisGuard, Inc. / Nguyen Cong Thinh, Y5cafe | | 23-Dec-2020 |
|
D2020-2742 | haircaregroup.com | Privity Pty. Ltd. | Whois Agent, Domain Protection Services, Inc. / Rightside Group, Ltd. | | 23-Dec-2020 |
|
D2020-2719 | beautybayonline.com | Beauty Bay Limited Dotcom Retail Limited | Contact Privacy Inc. Customer 0158825396 / Rhonan Moore, Beauty Bay | | 20-Dec-2020 |
|
D2020-2656 | alstyleapparelltd.com | Gildan Activewear SRL | Akhlaq Ahmad, Cyber Hosting | | 16-Dec-2020 |
|
D2020-2948 | hileinstagram.com | Instagram, LLC | Yi Mo Nian Ai Ni | | 22-Dec-2020 |
|
D2020-2920 | fragonard.fun | Les Parfumeries Fragonard | Thanh Van Pham | | 21-Dec-2020 |
|
D2020-2864 | taseryou.com | Axon Enterprise, Inc. | Domain Admin, Privacy Protect, LLC (PrivacyProtect.org) / JC, ITHappy | | 21-Dec-2020 |
|
D2020-2862 | flchangehealthcare.com | Change Healthcare Operations, LLC | Name Redacted | | 18-Dec-2020 |
|
D2020-2819 | boehringeringelmeimpetrebates.com | Boehringer Ingelheim Pharma Gmbh & Co.Kg | Domain Administrator, Fundacion Privacy Services LTD | | 19-Dec-2020 |
|
D2020-2802 | alstomgridco.com | Alstom | jeremiah poole | | 14-Dec-2020 |
|
D2020-3320 | netflix.shop | Netflix, Inc. | - | | TERMINATED
|
|
D2020-3286 | openfittoday.com | Openfit, LLC | - | | TERMINATED
|
|
103428 | amanrosaalpina.com | Aman Group S.A.R.L. | Jamaican Jerk Ltd | | 04-Jan-2021 |
|
DNL2020-0031 | humveesale.nl | AM General LLC | - | | TERMINATED
|
|
1923347 | tranasamerica.com transameerica.com | Transamerica Corporation | Zhichao Yang | UDRP | 30-Dec-2020 |
|
1924258 | availitys.com | Availity, L.L.C. | Thomas Hutton / Thomas LLC | UDRP | 31-Dec-2020 |
|
1923147 | transamericca.com | Transamerica Corporation | Jin Dong Li / Li Jin Dong | UDRP | 31-Dec-2020 |
|
1921923 | instacart.top | Maplebear Inc. DBA Instacart | lin xian he | UDRP | 31-Dec-2020 |
|
1923146 | transmaerica.com | Transamerica Corporation | Domain Administrator / Fundacion Privacy Services LTD | UDRP | 30-Dec-2020 |
|
1921833 | mstanley-international.com | Morgan Stanley | Gary Fox | UDRP | 31-Dec-2020 |
|
1921890 | pfister.design | Spectrum Brands, Inc. | Liu Yun Yun | UDRP | 31-Dec-2020 |
|
1921798 | youtubeconverterfree.org youtubedownloaderfree.org youtubemp3free.org | Google LLC | Fayva / J. Fink Ivana / Mark Kei / Home | UDRP | 31-Dec-2020 |
|
1921478 | smartcode.cloud smartcode.design | Spectrum Brands, Inc. | huang zhenyu / SERVICIOS WEB YURY LLORCA DE LA NOVAL E.I.R.L / Yury Llorca | UDRP | 30-Dec-2020 |
|
1923475 | statefarmgiftcard.com | State Farm Mutual Automobile Insurance Company | Carolina Rodrigues / Fundacion Comercio Electronico | UDRP | 30-Dec-2020 |
|
1923620 | longhornsgearshop.com | The Board of Regents of The University of Texas System | Amanda Lean | UDRP | 30-Dec-2020 |
|
1923351 | transaqmerica.com | Transamerica Corporation | Carolina Rodrigues / Fundacion Comercio Electronico | UDRP | 30-Dec-2020 |
|
1920377 | holmanautos.net | Holman Enterprises, Inc. | James Chris | UDRP | 30-Dec-2020 |
|
1921474 | storagegoogleapis.com | Google LLC | Milen Radumilo | UDRP | 30-Dec-2020 |
|
1919946 | arlocamera-setup.com | Arlo Technologies, Inc. | nikhil kumar | UDRP | 30-Dec-2020 |
|
DCO2020-0083 | babydopplers.co | Dagamma Ecommerce Solutions Inc. | WhoisGuard, Inc. / Kyle Gyr | | 24-Dec-2020 |
|
DCO2020-0074 | blaige.co | Thomas Blaige & Company, LLC | Redacted for privacy / Kevin F Ford | | 21-Dec-2020 |
|
DIO2020-0014 | rxmeds.io | RXMEDZ PTE. LTD. | Smith John | | 28-Dec-2020 |
|
D2020-2685 | behance.pro behancer.top | Adobe Inc. | Петров Сергей Игоревич / Petrov Sergey, Малявкин Павел Сергеевич / Malyavkin Pavel | | 21-Dec-2020 |
|
D2020-2943 | cheaponrunningshoes.comoncloudcanada.comoncloudshoessale.comonlobesko.com onrunnersaustralia.com onrunningcanada.com onrunningshoessale.com onrunningshoesuk.com onrunninguk.com runnersonsaleireland.com [7 MORE] | On AG On Clouds GmbH, c/o On AG | Domain Admin, Privacy Protect LLC / Bettina Presser Domain Administrator / Johanna Koehler Domain Administrator / Helle Mynster Domain Administrator / Mathias Hartman Domain Administrator / Mitja Schmidt Domain Administrator / Tonnis Wolthuis Katja Eberhardt Lukas Ziegler Patrick Kalb Stefan Neumann | | 21-Dec-2020 |
|
D2020-2893 | citimortgagesrates.com | Citigroup Inc. | Registration Private of Domains By Proxy, LLC / Suheil Aguilar, ALG | | 28-Dec-2020 |
|
D2020-2881 | fredexeuropa.com | Federal Express Corporation | Alfredas Grubliauskis, Fredex Europa ltd | | 28-Dec-2020 |
|
D2020-2812 | igreels.com | Instagram, LLC | Anas Abdullah | | 23-Dec-2020 |
|
D2020-3095 | sodexo-hk.com | Sodexo | - | | TERMINATED
|
|
1923522 | statefarmllc.com | State Farm Mutual Automobile Insurance Company | Nnadi Nnanna / Deloo | UDRP | 29-Dec-2020 |
|
1924132 | verbraucherritter.org | ECR European Consumer Rights GmbH | WhoisGuard, Inc. | URS | 30-Dec-2020 |
|
1920895 | morgansfanley.com | Morgan Stanley | Jack Franco | UDRP | 30-Dec-2020 |
|
D2020-3228 | ibmsort.comibmzsort.comsortibm.comsortibmz.com [1 MORE] | International Business Machines (IBM) | - | | TERMINATED
|
|
103442 | novartis-int.com | Novartis AG | Eric Ballora | | 30-Dec-2020 |
|
1923409 | crunchbaseexchange.com | Crunchbase, Inc. | crun block / crun | UDRP | 29-Dec-2020 |
|
1923509 | cengagedeals.com | Cengage Learning, Inc. | Tran Dinh Dong | UDRP | 29-Dec-2020 |
|
1923481 | macfromstatefarm.com | - | - | UDRP | WITHDRAWN
|
|
1923348 | zelle-pays.us zellepays.us | Early Warning Services, LLC | Dekari Wright | USDRP | 29-Dec-2020 |
|
1923289 | bitmexinvestment.com | HDR Global Trading Limited | Theodore Ezechinwoye / Wave4 Technologies | UDRP | 29-Dec-2020 |
|
1923323 | cozychicshop.com | Barefoot Dreams, Inc. | rilang haung | UDRP | 29-Dec-2020 |
|
1922009 | youtubemp3.biz | Google LLC | Nafiz / NZNBD | UDRP | 28-Dec-2020 |
|
1923145 | transamrica.com | Transamerica Corporation | Domain Admin / Whois Privacy Corp. | UDRP | 29-Dec-2020 |
|
1921905 | stanthonyevergreen.org | Centura Health Corporation | Mason Soiza | UDRP | 29-Dec-2020 |
|
1920818 | dewberry.us | Dewberry Engineers Inc. | Chen Carlo | USDRP | 29-Dec-2020 |
|
1921189 | bottegavenetabags.us | LUXURY GOODS INTERNATIONAL (L.G.I.) SA | Cynthia Peters | USDRP | 27-Dec-2020 |
|
1920442 | bentoboxent.us | Fox Media LLC | William Smith | USDRP | 28-Dec-2020 |
|
1920671 | dockerinfinity.com | Docker, Inc. | Shubham Kaushik | UDRP | 28-Dec-2020 |
|
1920060 | upsdeliverycompany.com | United Parcel Service of America, Inc. | Franklin Fennell / militarydodn | UDRP | 28-Dec-2020 |
|
1920269 | cirrus-ic.com | Cirrus Logic, Inc. | TAMS CAI / CAI JIANPING | UDRP | 27-Dec-2020 |
|
DCO2020-0084 | bfgoodrichtire.co | Compagnie Générale des Etablissements Michelin | Sarah Hampton | | 21-Dec-2020 |
|
DEC2020-0001 | omnilife.com.ec | GRUPO OMNILIFE, S.A. DE C.V. | Ruisdael García Cantos | | 18-Dec-2020 |
|
DES2020-0040 | superlenny.es | Betit Operations Limited | Christian Karlsson | | 18-Dec-2020 |
|
DES2020-0037 | androidbox.es | Google LLC | Serafín Frías Cuevas | | 14-Dec-2020 |
|
D2020-2723 | hispasat.site | HISPASAT, S.A. | Fernando Valle, INTERMX | | 14-Dec-2020 |
|
D2020-2676 | ajctoday.com | Cox Enterprises, Inc. | Miguel Delsel | | 24-Dec-2020 |
|
D2020-2996 | virginverizonwireless.com | Virgin Enterprises Limited | "Richards Branson" | | 21-Dec-2020 |
|
D2020-2968 | oney.live oney1.live | ONEY BANK, | Xiao Long Lin, A La Si Jia | | 23-Dec-2020 |
|
D2020-2959 | osram.expert | OSRAM GmbH | Maike Tasci | | 21-Dec-2020 |
|
D2020-2958 | gainvest.com | Gainvest Holdings, LLC Gainvest Legal Corporation | Gainvest, Gainvest | | 22-Dec-2020 |
|
D2020-2939 | skycanner.com | Skyscanner Limited | Domain Administrator | | 21-Dec-2020 |
|
D2020-2902 | virginstartupasian.org | Virgin Enterprises Limited | Douglas N. Harris | | 21-Dec-2020 |
|
D2020-2898 | sefiaintercredit.com | Compagnie Générale De Location D’Equipements | Louis Finon | | 23-Dec-2020 |
|
D2020-2892 | ysl-singapore.com | Yves Saint Laurent | Lin Yunfei | | 21-Dec-2020 |
|
D2020-2888 | prenelove.com | Teresa Brooks Chad Brooks Corporation: 11809107 Canada Inc. | Frank Zhang, Casewee Trading Co., Ltd. | | 17-Dec-2020 |
|
D2020-2844 | rnichelin.com | Compagnie Générale des Etablissements Michelin | WhoisGuard Protected, WhoisGuard, Inc. / Elaine Hall | | 22-Dec-2020 |
|
D2020-2831 | natixis-investissement.com | Natixis | Gouny Daniel | | 20-Dec-2020 |
|
D2020-2803 | e-leclercfrance.com | Association des Centres Distributeurs E. Leclerc – A.C.D. Lec | Alain Dupiet | | 18-Dec-2020 |
|
103424 | canalplusvpn.com | GROUPE CANAL + | Icarus Media Digital | | 29-Dec-2020 |
|
103435 | bousoramas.com | BOURSORAMA SA | lucien gunoiseau | | 29-Dec-2020 |
|
1923382 | garmin-online.store | Garmin Switzerland GmbH | les couz / smart | UDRP | 28-Dec-2020 |
|
1923341 | brassfieldsgorriee.com | Brasfield & Gorrie, L.L.C. | hivou Metto / Metto Inc | UDRP | 28-Dec-2020 |
|
1923154 | transamericaiseries.online | Transamerica Corporation | Jeff Wylie / Wylie Creative | UDRP | 28-Dec-2020 |
|
1923264 | trstransamerica.com | Transamerica Corporation | Carolina Rodrigues / Fundacion Comercio Electronico | UDRP | 28-Dec-2020 |
|
1921973 | youtubemp4.biz | Google LLC | Cang hua / Canghua | UDRP | 28-Dec-2020 |
|
1922040 | barclaysx.com | Barclays PLC | aryan king | UDRP | 28-Dec-2020 |
|
1921864 | brink-courierservice.combrinkcourier.combrinkcouriersecurityservice.combrinkscourierservice.com [1 MORE] | Brink’s Network, Incorporated | Michael Brooks / Ivan Heini / Jan Jenny / Princewill / Pbells Inc. | UDRP | 28-Dec-2020 |
|
1921179 | spectrum-voice.com | Charter Communications Holding Company, LLC | charles bridges / Innovative Communications | UDRP | 28-Dec-2020 |
|
1921143 | swishersweet.infoswishersweet.netswishersweet.orgswishersweets.info swishersweets.org [2 MORE] | Swisher International, Inc. | Peter Malandrinos | UDRP | 28-Dec-2020 |
|