D2020-3107 | discoverbankk.com | Discover Financial Services | Registration Private, Domains By Proxy, LLC / Carolina Rodrigues, Fundacion Comercio Electronico | | 01-Jan-2021 |
|
D2020-3428 | geicocu1.com | Government Employees Insurance Company | - | | TERMINATED
|
|
1927077 | whoville.city | DR. SEUSS ENTERPRISES, L.P. | Daniel L. Devoe | URS | 06-Jan-2021 |
|
1924242 | juulplugmx.com | JUUL Labs, Inc. | Felix Tijerina Martinez / Juul Plug Mx | UDRP | 06-Jan-2021 |
|
1924346 | darucell.com | Duracell U.S. Operations, Inc. | feely mac | UDRP | 06-Jan-2021 |
|
1924127 | dowjonesauto.com | Dow Jones Trademark Holdings LLC | salvatore castro | UDRP | 06-Jan-2021 |
|
1924133 | hansgrohe-iran.com | Hansgrohe SE | Farshad Bastani / HANSGROHE | UDRP | 06-Jan-2021 |
|
1923913 | srsdistrlbution.com | SRS Distribution Inc. | Tina Tuohey | UDRP | 06-Jan-2021 |
|
1923922 | 0ornhub.com | Licensing IP International S.à.r.l. | Itech Me | UDRP | 06-Jan-2021 |
|
1923491 | statsefarm.com | State Farm Mutual Automobile Insurance Company | Domain Admin / Whois Privacy Corp. | UDRP | 06-Jan-2021 |
|
DES2020-0047 | googlefirstposition.es | Google LLC | Antonio Valle | | 26-Dec-2020 |
|
DIR2020-0023 | catia.ir | Dassault Systèmes SE | alireza shams, Baloot Rayaneh co. | | 24-Dec-2020 |
|
DMD2020-0004 | parimatch.md | Ericius Investments Limited | Zdorov Iuri IDNP 0972406891242 | | 25-Dec-2020 |
|
DSE2020-0051 | metrima.se | Metrima International AB | M2 Gävle Centrum AB | | 29-Dec-2020 |
|
D2020-1781 | sanofiaventispakltd.com | Sanofi | Super Privacy Service LTD c/o Dynadot / blessing hosting | | 16-Dec-2020 |
|
D2020-2551 | oanda-hk.com oanda.me oandartw.com | OANDA Corporation | Registration Private, Domains By Proxy, LLC / Wenshan Lin Tao LiQiang (涛力强) WhoisGuard, Inc. / Guobing Li | | 27-Dec-2020 |
|
D2020-2548 | cvtimeline.com | Toolbox for HR Spółka Z Ograniczoną Odpowiedzialnością Spółka Komandytowa | Domains By Proxy, LLC / Marco Yammine | | 22-Dec-2020 |
|
D2020-2514 | klarnarewards.com | Klarna Bank AB | 钱梦聃 (qianmengdan) | | 28-Dec-2020 |
|
D2020-2777 | accenture-insigth.com | Accenture Global Services Limited | dejoye florian (FLORIAND34379) | | 24-Dec-2020 |
|
D2020-2765 | valeraenergy.com | Valero Energy Corporation Valero Marketing and Supply Company | - | | TERMINATED
|
|
D2020-2755 | valeroenergygroup.com | Valero Energy Corporation Valero Marketing and Supply Company | WhosiGuard Protected / Froedtert Health | | 30-Dec-2020 |
|
D2020-2704 | loanatixisinvestment.com | Natixis | WhoisSecure /Ade Banjo | | 21-Dec-2020 |
|
D2020-2660 | dycomin.com | Dycom Industries, Inc. | Elif Bayrak | | 20-Dec-2020 |
|
D2020-2903 | mothersspeedclaydemo.com | Mothers Polishes Waxes Cleaners Incorporated | WIS Inc. | | 28-Dec-2020 |
|
D2020-2856 | acces-credit-mutuel.com | Confederation Nationale Du Credit Mutuel | Roulier Serge, Roulier Serge | | 21-Dec-2020 |
|
D2020-3054 | flirt4frees.com | VS Media, Inc. | Lee Chang | | 30-Dec-2020 |
|
D2020-3051 | cantorcareers.com | Cantor Fitzgerald Securities | Wanda J. Bradley | | 30-Dec-2020 |
|
D2020-3011 | cn-sannofi.com | Sanofi | Bradley Perkey, greenhood | | 29-Dec-2020 |
|
D2020-3407 | noreply-tiktok.com | Bytedance Ltd. | - | | TERMINATED
|
|
103429 | pentair.icu | Pentair Flow Services AG | Domain Administrator / See PrivacyGuardian.org | | 06-Jan-2021 |
|
103434 | b0ehringer-ingelhelm.com | Boehringer Ingelheim Pharma GmbH & Co.KG | brenda llc | | 06-Jan-2021 |
|
103432 | account-transportexchangegroup.comacctransportexchangegroup.comaddress-transportexchangegroup.comap-transportexchangegroup.com app-transportexchangegroup.com appc-transportexchangegroup.com apps-transportexchangegroup.com cx-transportexchangegroup.com cxx-transportexchangegroup.com cxxtransportexchangegroup.com documents-transportexchangegroup.com etransportexchangegroup.com eu-transportexchangegroup.com eutransportexchangegroup.com extransportexchangegroup.com update-transportexchangegroup.com verify-transportexchangegroup.com [14 MORE] | Transport Exchange Group Limited | Martin Miller | | 06-Jan-2021 |
|
1924313 | michelefanallestatefarm.com | State Farm Mutual Automobile Insurance Company | W S / WIS INC | UDRP | 05-Jan-2021 |
|
1925204 | huntsman.tech | Huntsman International, LLC | heng si mai ke ji ( guang zhou ) you xian gong si et al. | URS | 05-Jan-2021 |
|
1924267 | ejuulpod.com | JUUL Labs, Inc. | raymond Junior | UDRP | 05-Jan-2021 |
|
1924261 | cdwgv.com | CDW LLC | Addison Dorrance | UDRP | 05-Jan-2021 |
|
1924246 | juulpodshop.com | JUUL Labs, Inc. | Mary Ghandir | UDRP | 05-Jan-2021 |
|
1923493 | averyksinger.com | Avery Kusmierski Singer | Domain Administrator / See PrivacyGuardian.org | UDRP | 05-Jan-2021 |
|
1923893 | meticoresale.onlinemeticoreweightloss.commymeticore.commymeticoreofficialstore.com [1 MORE] | Amity Holdings, LLC | Pallis Press / Woratanat Ratchatanyatorn / Mehmet Mehliz / oyunstore.com / aydın dedeoğlu | UDRP | 05-Jan-2021 |
|
1923310 | acilawaz.com | ACI LAW GROUP, PC | Haia Abdel-Jaber / ACI Law Group PLLC | UDRP | 05-Jan-2021 |
|
1923275 | ciscobu.com | Cisco Technology, Inc. | Eugene Olexandrovych Oseredko | UDRP | 05-Jan-2021 |
|
1923254 | ciscobraindump.com | Cisco Technology, Inc. | BY / Raymond Wang | UDRP | 05-Jan-2021 |
|
1914983 | accuair.com | Arnott, LLC | Dustin Heon / AccuAir Suspension, LLC | UDRP | 05-Jan-2021 |
|
DCN2020-0036 | fxcmhk.com.cn | FXCM Global Services, LLC | 廖春桃 (Chun Tao Liao) | | 28-Dec-2020 |
|
DIO2020-0007 | snowflakelabs.io | Snowflake, Inc. | Ezra Silverman | | 04-Dec-2020 |
|
DNL2020-0046 | bett1.nl | bett1.de GmbH | DIBMat GmbH | | |
|
D2020-2796 | heetsperpa.com | Philip Morris Products S.A. | Turan Altunoglu | | 15-Dec-2020 |
|
D2020-2787 | fonbet.biz | Fonbet Corp. | - | | TERMINATED
|
|
D2020-2753 | bmwfairfield.com | Bayerische Motoren Werke AG | Chris Miranda | | 25-Dec-2020 |
|
D2020-2713 | fmdfinanciallimited.com | Fmd Financial Pty Ltd | Domain Administrator, See PrivacyGuardian.org / Nike Nolan | | |
|
D2020-2634 | santa-toeic.cosanta-toeic.comsantafortoeic.comsantatoeic.co santatoeic.com [2 MORE] | Educational Testing Service | Riiid Riiid!, Inc. / santa riiid, Riiid | | 30-Dec-2020 |
|
D2020-2991 | remotesidley.com | Sidley Austin LLP | Domain Administrator, Fundacion Privacy Services LTD | | 26-Dec-2020 |
|
D2020-2942 | tysonfoodgroup.com | Tyson Foods, Inc. | tim garry, Timm | | 24-Dec-2020 |
|
D2020-2912 | consumersreportz.com | Consumer Reports, Inc. | semalee bilbreys | | 30-Dec-2020 |
|
D2020-3077 | summitbicycles.com | Summit Bicycles | Privacy.co.com - 250a3 / IF NETWORK, IF NETWORK | | 27-Dec-2020 |
|
D2020-3035 | swisstennisstats.com | Swiss Tennis | - | | TERMINATED
|
|
D2020-3446 | babesofonlyfans.com | Fenix International Limited | - | | TERMINATED
|
|
103343 | novartsi.com | Novartis AG | Riccardo Weingart , (GRAVA99180) | | 05-Jan-2021 |
|
103440 | ratplogistics.com | REGIE AUTONOME DES TRANSPORTS PARISIENS (RATP) | faruk sayan | | 05-Jan-2021 |
|
1919688 | walgreensrxcard.com | - | - | UDRP | WITHDRAWN
|
|
D2020-3445 | onlyfans.page | Fenix International Limited | - | | TERMINATED
|
|
103408 | bnp-paribas-fortis.com | BNP PARIBAS | jodenij kuipers | | 05-Jan-2021 |
|
103334 | alberghiconfindustria.com | Confederazione Generale dell'Industria Italiana - CONFINDUSTRIA Associazione Italiana Confindustria Alberghi | Stefan Paraniac | | 05-Jan-2021 |
|
1923730 | statefarm-southeast.com | State Farm Mutual Automobile Insurance Company | Mindy Stricklin / SF SouthEast | UDRP | 04-Jan-2021 |
|
1923733 | statefarmphoenix.com statefarmscottsdale.com | State Farm Mutual Automobile Insurance Company | Bryan Shisler / AMFAM | UDRP | 04-Jan-2021 |
|
1923705 | careers-davita.com | DaVita Inc. | Shawn Leckie | UDRP | 04-Jan-2021 |
|
1923515 | snap2meuf.com | Snap Inc. | cieluck laurent | UDRP | 04-Jan-2021 |
|
1923457 | youtubebyclick.com | Google LLC | Nir Schwartz | UDRP | 04-Jan-2021 |
|
1923281 | mammohologic.com | Hologic, Inc. | Вячеслав | UDRP | 04-Jan-2021 |
|
1923420 | dellbattery.net | Dell Inc. | face coolss / iuvclampt | UDRP | 04-Jan-2021 |
|
1921462 | webstetbank.com | Webster Financial Corporation and Webster Bank, National Association | Carolina Rodrigues / Fundacion Comercio Electronico | UDRP | 04-Jan-2021 |
|
1925314 | comunidad.app tucomunid.app tucomunidad.app | INFORMATIZACION DE EMPRESAS, S.L.U. (IESA) | Soluciones Corporativas IP, c/o Whois Proxy et al. | URS | 04-Jan-2021 |
|
1925185 | amazon-deals.co | Amazon Technologies, Inc. | Sidra Aziz | UDRP | 04-Jan-2021 |
|
1924073 | medcamember.com | Medica Health Plans | Robert K. Mueller / This domain is for Sale | UDRP | 04-Jan-2021 |
|
1924122 | 420lyftd.com | Lyft, Inc. | Stickyleaf Software / Stickyleaf | UDRP | 04-Jan-2021 |
|
1923736 | statefarmpay.online | State Farm Mutual Automobile Insurance Company | hennry williamson | UDRP | 04-Jan-2021 |
|
DAE2020-0005 | tevapharm.ae | Actavis Group PTC ehf | Personal Email | | 10-Dec-2020 |
|
DCO2020-0058 | sodexous.co | Sodexo | WhoisGuard Protected, WhoisGuard, Inc. / Liliane Walton | | 14-Dec-2020 |
|
DES2020-0038 | jdsports.com.es | JD Sports Fashion PLC | Ana García Hernández | | 15-Dec-2020 |
|
DIO2020-0015 | msfinance.io msfunds.io | Morgan Stanley | Registration Private, Domains By Proxy, LLC / Ismail Sokhna, Talibe Sokhna | | 23-Dec-2020 |
|
DSE2020-0048 | kranmärkt.se | Svenskt Vatten AB | U.J., Konsulf | | 20-Dec-2020 |
|
D2020-1657 | laboratoriostevaargentina.com laboratoriotevaargentina.com | Teva Pharmaceutical Industries Limited | Felipe Gamboa / Francisco Ponse / Cindy Nicole Oporto Leal | | 22-Dec-2020 |
|
D2020-2529 | goldengoosehrvatska.com | Golden Goose S.p.A. | 邹亮亮 (Zou Liang Liang) | | 23-Dec-2020 |
|
D2020-2491 | velpeau.com | Laboratoires Lohmann & Rauscher Lohmann & Rauscher GmbH & Co.KG | zhengxiao xing (郑晓星), shen zhen shi wei li jian ke ji zhi pin you xian gong si (深圳市维力健科技制品有限公司), Shenzhen Weprotex Technology Product Co., Ltd | | 23-Dec-2020 |
|
D2020-2486 | guitarcentermusic.com | Guitar Center, Inc. | Luiz Carlos de Arruda Leite | | 15-Dec-2020 |
|
D2020-2424 | helpserviceinstagramverify.comhelpserviceinstagramverifys.cominstagramcopyrighthelpteam.cominstagramhelpcentering.com instagramhelpportal.com instagramhelpscentering.com lnstagram-businessmanagers.com lnstagramclientsportalcenter.com lnstagramcommunitycenter.com lnstagramcoprightes.com lnstagramportalscenter.com lnstagramspecialportals.com lnstagramsupporterscentre.com lnstagramsupportforms.com lnstagramsupportshelp.com lnstagramsupportsmedia.com [13 MORE] | Instagram, LLC | Ahmet Yalman dfd dfdf, dfdf efdwedf wedfwef erdem altan Hasan Yavuz, Jjjj Hhh Hhhh Jxksks Ksmssks Mirac Ertekin ndsmnxsj bzjsjxjs Nsnsnsn Snnndndn Nxnxnx Nxnxnxjsjskks Registration Private, Domains By Proxy, LLC rewgferwg ewgerg Xjjzjz Bzhzhhz Xjkdjd nxksjz | | 30-Dec-2020 |
|
D2020-2789 | pricelinehotline.com | priceline.com LLC | Ryan Foster | | 22-Dec-2020 |
|
D2020-2780 | seeklogo.net | Mr. Yunus GÖNEN | WhoiGuard Protected, WhoisGuard, Inc. WhoiGuard Protected, WhoisGuard, Inc. / Nguyen Cong Thinh, Y5cafe | | 23-Dec-2020 |
|
D2020-2742 | haircaregroup.com | Privity Pty. Ltd. | Whois Agent, Domain Protection Services, Inc. / Rightside Group, Ltd. | | 23-Dec-2020 |
|
D2020-2719 | beautybayonline.com | Beauty Bay Limited Dotcom Retail Limited | Contact Privacy Inc. Customer 0158825396 / Rhonan Moore, Beauty Bay | | 20-Dec-2020 |
|
D2020-2656 | alstyleapparelltd.com | Gildan Activewear SRL | Akhlaq Ahmad, Cyber Hosting | | 16-Dec-2020 |
|
D2020-2948 | hileinstagram.com | Instagram, LLC | Yi Mo Nian Ai Ni | | 22-Dec-2020 |
|
D2020-2920 | fragonard.fun | Les Parfumeries Fragonard | Thanh Van Pham | | 21-Dec-2020 |
|
D2020-2864 | taseryou.com | Axon Enterprise, Inc. | Domain Admin, Privacy Protect, LLC (PrivacyProtect.org) / JC, ITHappy | | 21-Dec-2020 |
|
D2020-2862 | flchangehealthcare.com | Change Healthcare Operations, LLC | Name Redacted | | 18-Dec-2020 |
|
D2020-2819 | boehringeringelmeimpetrebates.com | Boehringer Ingelheim Pharma Gmbh & Co.Kg | Domain Administrator, Fundacion Privacy Services LTD | | 19-Dec-2020 |
|
D2020-2802 | alstomgridco.com | Alstom | jeremiah poole | | 14-Dec-2020 |
|
D2020-3320 | netflix.shop | Netflix, Inc. | - | | TERMINATED
|
|
D2020-3286 | openfittoday.com | Openfit, LLC | - | | TERMINATED
|
|
103428 | amanrosaalpina.com | Aman Group S.A.R.L. | Jamaican Jerk Ltd | | 04-Jan-2021 |
|