D2018-1779 | snlego.com | LEGO Juris A/S | Dang Xin, Shan Xi Le Gao Dian Zi Ke Ji Fa Zhan You Xian Gong Si | | |
|
D2018-1777 | bmwbrooklyn.com | Bayerische Motoren Werke AG | Data Protected / L&M Foreign Cars | | 12-Oct-2018 |
|
D2018-1738 | petplan.app | Pet Plan Ltd | Domains By Proxy, LLC Varun Uppal | | 05-Oct-2018 |
|
D2018-1713 | sbarronewyorkpizza.com | Sbarro Franchise Co., LLC | “Expired domain caught by auction winner.***Maybe for sale on Dynadot Martketplace*** c/o Dynadot” | | 09-Oct-2018 |
|
D2018-1918 | piombo.com | 82 s.r.l. | Chris Grivas | | 06-Oct-2018 |
|
D2018-1897 | secure-gap.com | Gap (Apparel), LLC Gap (ITM) Inc. The Gap, Inc. | WhoisGuard Protected, WhoisGuard, Inc. / Stephen Bell | | 16-Oct-2018 |
|
D2018-1882 | hotelpullmancayococo.comhotelpullmancayococo.websitehotelsofitelagadirthalassasea-spa.websiteibisbarranquilla.website lediwanrabat-mgallerybysofitel.website mercureatenea-aventura.com mercurequemadoalhoceimaresort.website novotelcasablancacitycenter.website novotelrjbotafogo.website novoteltehranairport.website pullmanmarrakechpalmeraie.website pullmanmazaganroyal-golf-spa.website sofitelagadirroyalbay.website sofitelcasablanca-tourblanche.website sofitelessaouiramogador-golfspa.website sofitelmarrakechloungeandspa.website sofitelmarrakechpalaisimperial.website sofitelrabatjardindesroses.website [15 MORE] | Accor SA SoLuxury HMC | Orlando Andres Zunino, Sofia Project | | 05-Oct-2018 |
|
D2018-1861 | dreamstine.com | Dreamstime.com, LLC | Domain Admin, Domain Privacy Guard Sociedad Anónima Ltd | | 04-Oct-2018 |
|
D2018-1842 | bestiqos.com | Philip Morris Products S.A. | Liudinghong | | 05-Oct-2018 |
|
D2018-1834 | buscemi-online.com buscemi-outlet.com buscemi-sale.com | BUSCEMI LLC | Lao Yuan Dong Whois Agent, Whois Privacy Protection Service / Chen WenTing Xinnet Whois Privacy Pro Service / Sun Yanqi | | 12-Oct-2018 |
|
D2018-2089 | rakatan.com | Rakuten, Inc. | Pavel Zezulka | | 11-Oct-2018 |
|
D2018-2071 | usiqos.com | Philip Morris Products S.A. | - | | TERMINATED
|
|
1805374 | capital1forex.com | Capital One Financial Corp. | Milen Radumilo | UDRP | 15-Oct-2018 |
|
1806260 | transamericaa.com | Transamerica Corporation | ZHICHAO YANG | UDRP | 15-Oct-2018 |
|
1804902 | clips4salke.com | Wiluna Holdings, LLC | Zhichao Yang | UDRP | 16-Oct-2018 |
|
1804996 | clips4sae.com | Wiluna Holdings, LLC | Zhichao Yang | UDRP | 12-Oct-2018 |
|
1804510 | hologicparts.com usedhologic.com | Hologic, Inc. | Bojan Bjelac / Medical Imaging Services Inc | UDRP | 12-Oct-2018 |
|
1804441 | fxnetwork-activate.comfxnetworkactivate.comfxnetworks-activate-code.comfxnetworks-com-activate-roku.com [1 MORE] | Twentieth Century Fox Film Corporation and FX Networks, LLC | Rajakumar Pondicherry / Mike Scott | UDRP | 15-Oct-2018 |
|
D2018-1335 | topdeck.com | Top Deck Tours Limited | - | | TERMINATED
|
|
1806370 | delllaptoprepairandservicecentrekolkata.com | Dell Inc. | GOLDENWEB SOLUTION | UDRP | 15-Oct-2018 |
|
1805909 | medlineinc.com | Medline Industries, Inc. | Jeff Ramos | UDRP | 12-Oct-2018 |
|
DAU2018-0027 | hl7.com.au hl7education.com.au | Health Level Seven International, Inc HL7 Australia | Klaus Veil / HL7 Systems and Services | | 06-Oct-2018 |
|
D2018-1751 | fr-venteprivee.com | Vente‐privee.com Vente‐privee.com IP S.à.r.l. | Privacy Inc. Customer 0150839799 / Milen Radumilo | | 25-Sep-2018 |
|
D2018-1687 | bananamall.com | 우영균 주식회사 와이케이더블유(YKW inc.) | 차옥 | | 03-Oct-2018 |
|
D2018-1618 | hasznaltautok.com | Schibsted Classified Media Hungary | Vietnam Domain Privacy Services | | 05-Oct-2018 |
|
D2018-1953 | skyscannerusa.com | Skyscanner Limited | Registration Private, Domains By Proxy, LLC / I S, Internet Consulting Services Inc. | | |
|
D2018-1947 | peltonandcrane.com | Dental Equipment LLC | Above.com Domain Privacy / Transure Enterprise Ltd | | 10-Oct-2018 |
|
D2018-1921 | ibmmonitors.net | International Business Machines Corporation | Perfect Privacy, LLC / Computer Parts, Repair & Exchange | | 01-Oct-2018 |
|
D2018-1920 | foreverloveibm.com | International Business Machines Corporation | WhoisGuard Protected / Richard Anderson | | 01-Oct-2018 |
|
D2018-1905 | montar.com | Montar A/S | Domain Administrator, NameFind LLC | | 10-Oct-2018 |
|
D2018-1846 | osramd.com | OSRAM GmbH | yue tang, tangyue | | |
|
D2018-2167 | inauguration-boehringer-ingelheim-2018.com | Boehringer Ingelheim Pharma GmbH & Co. KG. | - | | TERMINATED
|
|
D2018-2086 | quechua.ooo | DECATHLON | - | | TERMINATED
|
|
1805841 | imdbapi.net | IMDB.COM, INC. | Pham Van Tuyen | UDRP | 12-Oct-2018 |
|
1804844 | clips4asle.com | Wiluna Holdings, LLC | New Ventures Services / New Ventures Services, Corp | UDRP | 12-Oct-2018 |
|
1805529 | oldbavy.com | The GAP, INC., Old Navy (Apparel), LLC and Old Navy (ITM) Inc. | Hulmiho Ukolen / Poste restante | UDRP | 15-Oct-2018 |
|
1804116 | onecause.org | BidPal, Inc. | Robert Bottorff / triptych | UDRP | 11-Oct-2018 |
|
1799759 | rootsofempathy.com | - | - | UDRP | WITHDRAWN
|
|
D2018-1717 | hotelnovotels.com | Accor | Contact Privacy Inc. Customer 0150635183 / Novotel Hotel | | 07-Oct-2018 |
|
D2018-2118 | sanofipro.com | Sanofi | - | | TERMINATED
|
|
DCO2018-0020 | valvolineignitionprogram.co | Valvoline Licensing and Intellectual Property LLC | Super Privacy Service LTD c/o Dynadot | | 28-Sep-2018 |
|
DMA2018-0002 | lepainquotidien.ma | P.Q. Licensing S.A. | Le Pain Quotidien | | 05-Oct-2018 |
|
D2018-1164 | cịc.comcịc.immocicmobile.clubcicmobile.immo cicmobile.works créditmutuel.co créditmutuel.immo créditmutuel.site [5 MORE] | Confederation Nationale Du Credit Mutuel Credit Industriel Et Commercial | Catherine Forali c/o WHOIStrustee.com Limited, Registrant of cicmobile.works Pierre Carminati, sv greis limited | | 29-Sep-2018 |
|
D2018-1373 | gotalmondmylk.comgothempmylk.comgotmusclemilk.comgotmusclemylk.com [1 MORE] | California Milk Processor Board | Catherine Rudat, Catherine Rudat's Corporate Wellness | | 19-Sep-2018 |
|
D2018-1421 | quadgirl.comquadgirl.infoquadgirl.netquadgirlmx.com [1 MORE] | Mary Victoria Kufeldt-Antle Quadgirl S. de r.l. De C.V. | Kelly MacRae Kelly Williamson Martín | | 12-Oct-2018 |
|
D2018-1783 | sz-lego.com | LEGO Juris A/S | Pu Yong Yan, Shen Zhen Shi Bai Bian Qian Li Wen Hua Chuan Bo You Xian Gong Si | | |
|
D2018-1748 | stadlpost.com | Stadl Media GmbH | Gernot Haberfellner Hui Min Song | | 01-Oct-2018 |
|
D2018-1728 | eemovers.com | E-Movers LLC | EEI Cargo Movers LLC Sohail Ayub, M Ayub Transport | | 09-Oct-2018 |
|
D2018-1719 | topdecathlon.com | Decathlon | Xuyue | | |
|
D2018-1860 | mediurn.com | A Medium Corporation | Marat Mukhamet | | 08-Oct-2018 |
|