102165 | arcelormnittal.com | ARCELORMITTAL S.A. | Pavla WoolDridge | | 18-Oct-2018 |
commonly accepted that the passive holding of a domain name would not prevent a finding of bad faith see WIPO Overview 3.0 paragraph 3.3 In these circumstances the panel must examine all circumstances of the case to determine whether the |
|
D2018-1782 | fly-scanner.com | Skyscanner Limited | Fabio Passal, BLUE SAS | | 05-Oct-2018 |
in bad faith where there is passive use of a widely known trade mark in a domain name where there is no response and no explanation as to why the use could be good faith see Telstra Corporation Limited v Nuclear Marshmallows WIPO Case No |
|
D2018-1581 | bulkwhatsapp.marketingtm-whatsappmasivo.comwasapmarketing.comwasappmarketing.com whatsappalertas.com whatsappemmassa.com whatsappemmassa.marketing whatsappmarketing.com.co whatsappmasivos.com wwwhatsappmarketing.com [7 MORE] | WhatsApp, Inc. | Domain Manager, SHOUT marketing SL Gonzalo Gomez Rufino, SHOUT Marketing SL Gonzalo Gomez Rufino, SHOUT marketing SL River Plate Argentina, Gonzalo Gomez Rufino whatsappmarketing.com.co, SHOUT marketing SL | | 28-Sep-2018 |
decisions have held that the passive holding of a domain name that incorporates a well ‘known trademark without obvious legitimate purpose may be deemed to be bad faith use under paragraph 4 a iii of the Policy.5 It seems to this Panel that there |
|
D2018-1937 | lorealfranchise.com | L’Oréal | Contact Privacy Inc. Customer 0149511181 / Jerry Peter | | 12-Oct-2018 |
is used in good faith Indeed passive holding does not preclude a finding of bad faith śA principle widely adopted by panels since shortly after the inception of the UDRP has been to examine all the surrounding circumstances in which a disputed |
|
102148 | contact-arcelormittal.com | ArcelorMittal (SA) | Arcelor Mittal | | 16-Oct-2018 |
certain circumstances the passive holding of a domain name cannot prevent a finding of bad faith Factors that have been considered relevant in applying the passive holding doctrine include i the degree of distinctiveness or reputation of the |
|
D2018-1713 | sbarronewyorkpizza.com | Sbarro Franchise Co., LLC | “Expired domain caught by auction winner.***Maybe for sale on Dynadot Martketplace*** c/o Dynadot” | | 09-Oct-2018 |
as here the domain name was passively held The passive holding doctrine is generally applied after consideration of the totality of the circumstances Complainant states that Respondent ™s bad faith is demonstrated primarily by the Domain Name ™s |
|
D2018-1882 | hotelpullmancayococo.comhotelpullmancayococo.websitehotelsofitelagadirthalassasea-spa.websiteibisbarranquilla.website lediwanrabat-mgallerybysofitel.website mercureatenea-aventura.com mercurequemadoalhoceimaresort.website novotelcasablancacitycenter.website novotelrjbotafogo.website novoteltehranairport.website pullmanmarrakechpalmeraie.website pullmanmazaganroyal-golf-spa.website sofitelagadirroyalbay.website sofitelcasablanca-tourblanche.website sofitelessaouiramogador-golfspa.website sofitelmarrakechloungeandspa.website sofitelmarrakechpalaisimperial.website sofitelrabatjardindesroses.website [15 MORE] | Accor SA SoLuxury HMC | Orlando Andres Zunino, Sofia Project | | 05-Oct-2018 |
content may be deemed as passive holding absent any actual offer of products or services or any information on any topic Several UDRP decisions have held that the passive holding of a domain name that incorporates a well ‘known trademark |
|
D2018-1164 | cịc.comcịc.immocicmobile.clubcicmobile.immo cicmobile.works créditmutuel.co créditmutuel.immo créditmutuel.site [5 MORE] | Confederation Nationale Du Credit Mutuel Credit Industriel Et Commercial | Catherine Forali c/o WHOIStrustee.com Limited, Registrant of cicmobile.works Pierre Carminati, sv greis limited | | 29-Sep-2018 |
faith under the doctrine of passive holding WIPO Overview 3.0 section 3.3 For the above reasons the Panel finds that the condition of paragraph 4 a iii of the Policy has been satisfied 7 Decision For the foregoing reasons in accordance with |
|
D2018-1748 | stadlpost.com | Stadl Media GmbH | Gernot Haberfellner Hui Min Song | | 01-Oct-2018 |
faith under the doctrine of passive holding ť See paragraph 3.3 of the WIPO Overview 3.0 In this case the Panel is convinced that the overall circumstances of this case strongly suggest that the Respondent ™s non-use of the Domain Name is in bad |
|
D2018-1817 | arcelormittal.top | ArcelorMittal (SA) | zhou zhou, zhou zhou | | |
reason for the Respondent ™s passive holding of the disputed domain name leads the Panel to infer that the Respondent has registered and used the disputed domain name in bad faith Therefore the Panel concludes that the Complainant has satisfied |
|
1806523 | prudential.app | The Prudential Insurance Company of America | REDACTED PRIVACY | URS | 11-Oct-2018 |
Furthermore the Respondent is passively holding the Domain Name which itself can be considered as a bad faith use of a domain name In the light of above registering a domain name corresponding to a reputable trademark and subsequent passive holding |
|
1805650 | herwayatmorganstanley.com herwaymorganstanley.com | Morgan Stanley | Brian Jaccoma | UDRP | 09-Oct-2018 |
to use the Domain Names The passive holding of a domain name containing a well known mark does not show a legitimate use or bona fide offering of goods and services Respondent does not have any rights or legitimate interests in the Domain Names |
|
1805319 | nsglba-txtdameritrade.com | TD Ameritrade IP Company, Inc. | Jim Wang / Private | UDRP | 10-Oct-2018 |
faith under the doctrine of passive holding While panelists will look at the totality of the circumstances in each case factors that have been considered relevant in applying the passive holding doctrine include i the degree of distinctiveness or |
|
102143 | credtagric.online | CREDIT AGRICOLE SA | Super Privacy Service LTD c/o Dynadot | | 09-Oct-2018 |
contact the trade mark holder passive holding does not as such prevent a finding of bad faith The panel must examine all the circumstances of the case to determine whether the respondent is acting in bad faith Examples of what may be cumulative |
|
DAU2018-0026 | tigerlily.com.au | TL IP Company Pty Ltd. | Melanie Smith, Tiger Lily Floral Design | | 05-Oct-2018 |
the Respondent ™s passive holding of the Disputed Domain Name does not prevent a finding of bad faith In light of the above and in the absence of a Response and any evidence rebutting bad faith use the Panel finds that the Complainant |
|
D2018-1804 | rockefellerqroup.com | Rockefeller Group International, Inc. | Registration Private, Domains By Proxy, LLC / Jason Mills | | 28-Sep-2018 |
faith under the doctrine of passive holding While panelists will look at the totality of the circumstances in each case factors that have been considered relevant in applying the passive holding doctrine include i the degree of distinctiveness or |
|
D2018-1492 | cicbanque.online cicsecure.online | Credit Industriel et Commercial S.A. | Sarah Morine | | 29-Sep-2018 |
faith under the doctrine of passive holding WIPO Overview 3.0 section 3.3 For the above reasons the Panel finds that the condition of paragraph 4 a iii of the Policy has been satisfied 7 Decision For the foregoing reasons in accordance with |
|
D2018-1747 | sanofei.com | Sanofi | steven shao | | |
relevant in applying the passive holding doctrine include i the degree of distinctiveness or reputation of the complainant ™s mark ii the failure of the respondent to submit a response or to provide any evidence of actual or contemplated |
|
1803818 | lcom-mail.net | Infinite Electronics International, Inc. | Frank Laidsaar / LaidsaarCom | UDRP | 03-Oct-2018 |
faith under the doctrine of passive holding While panelists will look at the totality of the circumstances in each case factors that have been considered relevant in applying the passive holding doctrine include i the degree of distinctiveness or |
|
DEU2018-0016 | klarnabank.eu | Klarna Bank AB (publ) | Siobhan Pankhurst | | 16-Sep-2018 |
a registrar parking website Passive holding does not preclude a finding of abusive registration B Respondent The Respondent did not reply to the Complainant ™s contentions in its email dated July 23 2018 6 Discussion and Findings According to |
|