| D2018-1882 | hotelpullmancayococo.comhotelpullmancayococo.websitehotelsofitelagadirthalassasea-spa.websiteibisbarranquilla.website lediwanrabat-mgallerybysofitel.website mercureatenea-aventura.com mercurequemadoalhoceimaresort.website novotelcasablancacitycenter.website novotelrjbotafogo.website novoteltehranairport.website pullmanmarrakechpalmeraie.website pullmanmazaganroyal-golf-spa.website sofitelagadirroyalbay.website sofitelcasablanca-tourblanche.website sofitelessaouiramogador-golfspa.website sofitelmarrakechloungeandspa.website sofitelmarrakechpalaisimperial.website sofitelrabatjardindesroses.website [15 MORE] | Accor SA SoLuxury HMC | Orlando Andres Zunino, Sofia Project | | 05-Oct-2018 |
|
| D2018-1861 | dreamstine.com | Dreamstime.com, LLC | Domain Admin, Domain Privacy Guard Sociedad Anónima Ltd | | 04-Oct-2018 |
|
| D2018-1842 | bestiqos.com | Philip Morris Products S.A. | Liudinghong | | 05-Oct-2018 |
|
| D2018-1834 | buscemi-online.com buscemi-outlet.com buscemi-sale.com | BUSCEMI LLC | Lao Yuan Dong Whois Agent, Whois Privacy Protection Service / Chen WenTing Xinnet Whois Privacy Pro Service / Sun Yanqi | | 12-Oct-2018 |
|
| D2018-2089 | rakatan.com | Rakuten, Inc. | Pavel Zezulka | | 11-Oct-2018 |
|
| D2018-2071 | usiqos.com | Philip Morris Products S.A. | - | | TERMINATED
|
|
| 1805374 | capital1forex.com | Capital One Financial Corp. | Milen Radumilo | UDRP | 15-Oct-2018 |
|
| 1806260 | transamericaa.com | Transamerica Corporation | ZHICHAO YANG | UDRP | 15-Oct-2018 |
|
| 1804902 | clips4salke.com | Wiluna Holdings, LLC | Zhichao Yang | UDRP | 16-Oct-2018 |
|
| 1804996 | clips4sae.com | Wiluna Holdings, LLC | Zhichao Yang | UDRP | 12-Oct-2018 |
|
| 1804510 | hologicparts.com usedhologic.com | Hologic, Inc. | Bojan Bjelac / Medical Imaging Services Inc | UDRP | 12-Oct-2018 |
|
| 1804441 | fxnetwork-activate.comfxnetworkactivate.comfxnetworks-activate-code.comfxnetworks-com-activate-roku.com [1 MORE] | Twentieth Century Fox Film Corporation and FX Networks, LLC | Rajakumar Pondicherry / Mike Scott | UDRP | 15-Oct-2018 |
|
| D2018-1335 | topdeck.com | Top Deck Tours Limited | - | | TERMINATED
|
|
| 1806370 | delllaptoprepairandservicecentrekolkata.com | Dell Inc. | GOLDENWEB SOLUTION | UDRP | 15-Oct-2018 |
|
| 1805909 | medlineinc.com | Medline Industries, Inc. | Jeff Ramos | UDRP | 12-Oct-2018 |
|
| DAU2018-0027 | hl7.com.au hl7education.com.au | Health Level Seven International, Inc HL7 Australia | Klaus Veil / HL7 Systems and Services | | 06-Oct-2018 |
|
| D2018-1751 | fr-venteprivee.com | Vente‐privee.com Vente‐privee.com IP S.à.r.l. | Privacy Inc. Customer 0150839799 / Milen Radumilo | | 25-Sep-2018 |
|
| D2018-1687 | bananamall.com | 우영균 주식회사 와이케이더블유(YKW inc.) | 차옥 | | 03-Oct-2018 |
|
| D2018-1618 | hasznaltautok.com | Schibsted Classified Media Hungary | Vietnam Domain Privacy Services | | 05-Oct-2018 |
|
| D2018-1953 | skyscannerusa.com | Skyscanner Limited | Registration Private, Domains By Proxy, LLC / I S, Internet Consulting Services Inc. | | |
|